Domain assignment for gi|387626619|ref|YP_006062794.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
154 267 GHMP Kinase, C-terminal domain 3.5e-31 Homoserine kinase 0.01 1fwk A:168-300 Alignments
1 142 Ribosomal protein S5 domain 2-like 3.64e-30 GHMP Kinase, N-terminal domain 0.00086 1fwk A:5-167 Alignments

Protein Sequence Details

Sequence length 289
Comment homoserine kinase [Streptococcus pneumoniae INV104]
Sequence
MKIIVPATSANIGPGFDSVGVAVTKYLQIEVCEERDEWLIEHQIGKWIPHDERNLLLKIALQIVPDLQPRRLKMTSDVPLARGLGSSSSVIVAGIELANQLGQLNLSDHEKLQLATKIEGHPDNVAPAIYGNLVIASSVEGQVSAIVADFPECDFLAYIPNYELRTRDSRSVLPKKLSYKEAVAASSIANVAVAALLAGDMVTAGQAIEGDLFHERYRQDLVREFAMIKQVTKENGAYATYLSGAGPTVMVLASHDKMPTIKAELEKQPFKGKLHDLRVDTKGVRVEAK

Download

Sequence (FASTA)