Domain assignment for gi|387626619|ref|YP_006062794.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

	Start Residue	End Residue	Superfamily	Superfamily E-value	Family	Family E-value	Closest structure	View
	154	267	GHMP Kinase, C-terminal domain	3.5e-31	Homoserine kinase	0.01	1fwk A:168-300	Alignments
	1	142	Ribosomal protein S5 domain 2-like	3.64e-30	GHMP Kinase, N-terminal domain	0.00086	1fwk A:5-167	Alignments

Protein Sequence Details

Sequence length	289
Comment	homoserine kinase [Streptococcus pneumoniae INV104]
Sequence	MKIIVPATSANIGPGFDSVGVAVTKYLQIEVCEERDEWLIEHQIGKWIPHDERNLLLKIALQIVPDLQPRRLKMTSDVPLARGLGSSSSVIVAGIELANQLGQLNLSDHEKLQLATKIEGHPDNVAPAIYGNLVIASSVEGQVSAIVADFPECDFLAYIPNYELRTRDSRSVLPKKLSYKEAVAASSIANVAVAALLAGDMVTAGQAIEGDLFHERYRQDLVREFAMIKQVTKENGAYATYLSGAGPTVMVLASHDKMPTIKAELEKQPFKGKLHDLRVDTKGVRVEAK

Download

Sequence (FASTA)

---