Domain assignment for gi|387626613|ref|YP_006062788.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
53 122 ClpS-like 1.17e-23 Ribosomal protein L7/12, C-terminal domain 0.00016 1dd3 A:58-128 Alignments
3 50 Ribosomal protein L7/12, oligomerisation (N-terminal) domain 0.000000000000222 Ribosomal protein L7/12, oligomerisation (N-terminal) domain 0.001 1dd3 A:1-57 Alignments

Protein Sequence Details

Sequence length 122
Comment 50S ribosomal protein L7/L12 [Streptococcus pneumoniae INV104]
Sequence
MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAVAAADAADAGAAKDSFDVELTSAGDKKVGVIKVVREITGLGLKEAKELVDGAPALVKEGVATAEAEEIKTKLEEAGASVTLK

Download

Sequence (FASTA)