Domain assignment for gi|387626582|ref|YP_006062757.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
80 119 SAP domain 0.00000000748 SAP domain 0.0028 1h1j S: Alignments

Protein Sequence Details

Sequence length 332
Comment SAP domain protein [Streptococcus pneumoniae INV104]
Sequence
MNFFSKLFNLKQNNHNRDTNSDCNNFYLNELECGLTPGQLILIDWTQKTGRNYNFPRYFKYSLQIDPESTHNQLYKLGYFTKNKTLSYLTVVELKTILSKHNLATSGKKAELITRIINNVNIDNLDIPFEFKLTKEAQNLIIEHSDYIKAYYDKDISMEDYCKEKNNISFKATFGDIKWSLLNKQAHRNTVSGDFGCLSNTRKAQGRHLEQEGNIKHALIYYIESLIITISGLENNFSATDYPVYYPDSIPDYSLKHIQTLMESLSDDDYDFAFDEALFRFSILNANHFLSKEDIDYLRVNLPRSTAEEINNYLKKYECYSPLNNLELDDFE

Download

Sequence (FASTA)