Domain assignment for gi|387626545|ref|YP_006062720.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 163 RNase III domain-like 2.62e-50 RNase III catalytic domain-like 0.0000422 1o0w A:-1-167 Alignments
149 226 dsRNA-binding domain-like 3.61e-22 Double-stranded RNA-binding domain (dsRBD) 0.0018 1o0w A:168-236 Alignments

Protein Sequence Details

Sequence length 232
Comment ribonuclease III [Streptococcus pneumoniae INV104]
Sequence
MKELQTVLKNHFAIEFADKNLLETAFTHTSYANEHRLLKISHNERLEFLGDAVLQLLISEYLYKKYPKKPEGDLSKLRAMIVREESLAGFARDCQFDQFIKLGKGEEKSGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFIYQVMIPKVEAGEFEMITDYKTHLQELLQVNGDVAIRYQVISETGPAHDKVFDVEVLVEGKSIGQGQGRSKKLAEQEAAKNAVEKGLDSCI

Download

Sequence (FASTA)