Domain assignment for gi|387626535|ref|YP_006062710.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 170 Acyl-CoA N-acyltransferases (Nat) 9.14e-25 N-acetyl transferase, NAT 0.0077 1nsl A: Alignments

Protein Sequence Details

Sequence length 187
Comment hypothetical protein INV104_10640 [Streptococcus pneumoniae INV104]
Sequence
MIYLRKLKREDLMSLWEMAYSQLNPVWKQYDAPYYDDYQYFSNFKEFELQKSESILSNSNRLGIFVDDKLVGTVSRYWVCKQTRWMELGIGIYDKKFWNTGIGKVAMLQWIDRTFQDYLELEHLGLTTWSGNLGMMKLAEKLRMKKEAHIPKVRYYQGKYFDSIKYGILREDWEKINDGYYQINGNS

Download

Sequence (FASTA)