Domain assignment for gi|387626534|ref|YP_006062709.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
22 158 Acyl-CoA N-acyltransferases (Nat) 1.46e-23 N-acetyl transferase, NAT 0.0033 2cy2 A:1-174 Alignments

Protein Sequence Details

Sequence length 162
Comment acetyltransferase (GNAT) family protein [Streptococcus pneumoniae INV104]
Sequence
MTVIIKSMETPEEIEGKSLVHWQTWREAYDDLLPAEFQETMTLERCRFFSQKYPENTLIAIGDLKVVGFISYGNFRDETIQAGEIIALYVLKDYYGKGIAQKLMKAALTALNHFSEIFLWVLKDNKRAIAFYQKMGFTFDGQEKILELGKPIKEKRMVFYSK

Download

Sequence (FASTA)