Domain assignment for gi|387626525|ref|YP_006062700.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 121 CheY-like 7.4e-42 CheY-related 0.00000221 1nxo A: Alignments
130 231 C-terminal effector domain of the bipartite response regulators 4.54e-30 PhoB-like 0.00045 1ys7 A:128-233 Alignments

Protein Sequence Details

Sequence length 234
Comment response regulator protein [Streptococcus pneumoniae INV104]
Sequence
MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRSQPMPVDGQEADSKPQPIQIGDLEIVPDAYVAKKYGEELDLTHREFELLYHLASHTGQVITREHLLETVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYILTRRGVGYYMRNNA

Download

Sequence (FASTA)