Domain assignment for gi|387626519|ref|YP_006062694.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
149 316 LDH C-terminal domain-like 7.78e-57 Lactate & malate dehydrogenases, C-terminal domain 0.00000259 1llc A:165-334 Alignments
4 150 NAD(P)-binding Rossmann-fold domains 2.69e-50 LDH N-terminal domain-like 0.00000201 1llc A:13-164 Alignments

Protein Sequence Details

Sequence length 328
Comment L-lactate dehydrogenase [Streptococcus pneumoniae INV104]
Sequence
MTSTKQHKKVILVGDGAVGSSYAFALVNQGIAQELGIIEIPQLHEKAVGDALDLSHALAFTSPKKIYAAQYSDCADADLVVITAGAPQKPGETRLDLVGKNLAINKSIVTQVVESGFKGIFLVAANPVDVLTYSTWKFSGFPKERVIGSGTSLDSARFRQALAEKLDVDARSVHAYIMGEHGDSEFAVWSHANIAGVNLEEFLKDTQNVQEAELIELFEGVRDAAYTIINKKGATYYGIAVALARITKAILDDENAVLPLSVFQEGLYGVENVFIGQPAVVGAHGIVRPVNIPLNDAETQKMQASAKELQAIIDEAWKNPEFQEASKN

Download

Sequence (FASTA)