Domain assignment for gi|387626508|ref|YP_006062683.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
61 247 S-adenosyl-L-methionine-dependent methyltransferases 9.41e-20 RNA methyltransferase FtsJ 0.033 1ej0 A: Alignments
3 71 Alpha-L RNA-binding motif 0.0000000147 Ribosomal protein S4 0.036 1c06 A: Alignments

Protein Sequence Details

Sequence length 271
Comment hemolysin-like protein [Streptococcus pneumoniae INV104]
Sequence
MAKERVDVLAYKQGLFETREQAKRGVMAGLVVAVLNGERFDKPGEKIPDDTELKLKGEKLKYVSRGGLKLEKALQVFDLSVDGATTIDIGASTGGFTDVMLQNSAKLVFAVDVGTNQLAWKLRQDPRVVSMEQFNFRYAEKTDFEQEPSFASIDVSFISLSLILPALHSVLADQGQVVALVKPQFEAGREQIGKNGIIRDAKIHQNVLESVTAMAVEAGFSVLGLDFSPIQGGHGNIEFLAYLKKEKSASNQILAEIKEAVERAHSQFKNE

Download

Sequence (FASTA)