Domain assignment for gi|387626499|ref|YP_006062674.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
56 166 PTS-regulatory domain, PRD 1.03e-23 PTS-regulatory domain, PRD 0.00095 1h99 A:54-168 Alignments
174 277 PTS-regulatory domain, PRD 6.02e-17 PTS-regulatory domain, PRD 0.0043 1h99 A:169-275 Alignments
2 54 SacY-like RNA-binding domain 0.00000000000000523 BglG-like antiterminator proteins 0.0011 1l1c A: Alignments

Protein Sequence Details

Sequence length 278
Comment transcription antiterminator LacT 2 [Streptococcus pneumoniae INV104]
Sequence
MYRILNPMNHNVSLVRNDKGEEVIVIGKGIAFGKKKGDLIAENHVEKIFRMKTEESRENFMALLKDVPLDFITVTYEIIDKLSKKYHYPIQEYLYVTLTDHIYCSYQALIQGRYKDSNLPDISAKYPVAFQIANEAFEIYRQKLADHFPEDEIIRIAYHFINAEGENEVELVESIDKRKEILRNVEEVLTDYAIQRTKKNNHFYDRFMIHLNYFLDYLDRSRDDNQSLLDMEDHIKQSYPKAFEIGSKIYDVITQHTGLDLYKSERVYLVLHIQRLLS

Download

Sequence (FASTA)