Domain assignment for gi|387626458|ref|YP_006062633.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
36 87 Putative DNA-binding domain 0.000000201 Terminase gpNU1 subunit domain 0.027 1j9i A: Alignments

Protein Sequence Details

Sequence length 88
Comment hypothetical protein INV104_09810 [Streptococcus pneumoniae INV104]
Sequence
MEILSKEIQLQGLQLLKQTLETLVELEKQRSSKLDLISRKELMDLLGISATTLDNWEDLALKRYQTPMDGAKKVFYRLSDVYLFLAIK

Download

Sequence (FASTA)