Domain assignment for gi|387626453|ref|YP_006062628.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 129 YueI-like 5.89e-32 YueI-like 0.0039 2ohw A:3-130 Alignments

Protein Sequence Details

Sequence length 148
Comment hypothetical protein INV104_09750 [Streptococcus pneumoniae INV104]
Sequence
MTDLSKQLLEKAHGGLKINPDEQRRYLGTFEERVLGYVDIDTANSPQLEKGFLFILENLQEKAEPLFVKISPTIEFDKQVFYLKEAKETDSQATIVSEEHITSPFGLVIHSNAPVQVEEKDLRLAFPKLWEVKKEEPAKTSLWKKWFS

Download

Sequence (FASTA)