Domain assignment for gi|387626430|ref|YP_006062605.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
70 295 Pseudouridine synthase 5.12e-71 Pseudouridine synthase RsuA/RluD 0.0000324 1prz A: Alignments

Protein Sequence Details

Sequence length 298
Comment putative RNA pseudouridylate synthase [Streptococcus pneumoniae INV104]
Sequence
MRFEFIADEHVKVKTFLKKHEVSKGLLAKIKFRGGAILVNNQPQNATYLLDVGDYVTIDIPAEEGFETLEAIEHPLDILYEDDHFLVLNKPYGVASIPSVNHSNTIANFIKGYYVKQNYENQQVHIVTRLDRDTSGLMLFAKHGYAHARLDKQLQKKSIEKRYFALVKGDGHLEPEGEIIAPIARDEDSIITRRVAKGGKYAHTSYKIVASYGNIHLVYIHLHTGRTHQIRVHFSHIGFPLLGDDLYGGSLEDGIQRQALHCHYLSFYHPFLEQDLQLESPLPDDFSNLITQLSTNTL

Download

Sequence (FASTA)