Domain assignment for gi|387626420|ref|YP_006062595.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
16 92 RuvA domain 2-like 0.00000171 Hef domain-like 0.055 1x2i A:2-69 Alignments

Protein Sequence Details

Sequence length 226
Comment DNA repair protein RadC [Streptococcus pneumoniae INV104]
Sequence
MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQSLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLNTQNQIIHQQTIFIGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLIVSHSNYFSYREKTDLI

Download

Sequence (FASTA)