Domain assignment for gi|387626417|ref|YP_006062592.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
70 182 HprK N-terminal domain-like 4.97e-30 DRTGG domain 0.0025 2ioj A:206-325 Alignments
187 306 CBS-domain pair 2.02e-24 CBS-domain pair 0.0013 2yvx A:132-275 Alignments
314 423 Thioesterase/thiol ester dehydrase-isomerase 0.000000000328 PaaI/YdiI-like 0.014 1zki A:4-129 Alignments
12 58 "Winged helix" DNA-binding domain 0.000000577 GntR-like transcriptional regulators 0.084 1v4r A:1-100 Alignments

Protein Sequence Details

Sequence length 425
Comment putative DNA-binding protein [Streptococcus pneumoniae INV104]
Sequence
MSKHQEILSYLEELPVGKRVSVRSISNHLGVSDGTAYRAIKEAENRGIVETRPRSGTIRVKSQKVAIDRLTFAEIAEVTSSEVLAGQEGLEREFSKFSIGAMTEQNILSYLHDGGLLIVGDRTRIQLLALENENAVLVTGGFQVHDDVLKLANQKGIPVLRSKHDTFTVATMINKALSNVQIKTDILTVEKLYRPSHEYGFLRETDTVKDYLDLVRKNRSSRFPVINQHQVVVGVVTMRDAGDKSPSTTIDKVMSRSLFLVGLSTNIANVSQRMIAEDFEMVPVVRSNQTLLGVVTRRDVMEKMSRSQVSALPTFSEQIGQKLSYHHDEVVITVEPFMLEKNGVLANGVLAEILTHMTQDLVVNSGRNLIIEQMLIYFLQAVQIDDILRIQARIIHHTRRSAIIDYDIYHGHQIVSKANVTVKIN

Download

Sequence (FASTA)