Domain assignment for gi|387626407|ref|YP_006062582.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
96 205 Sigma2 domain of RNA polymerase sigma factors 1.96e-53 Sigma2 domain of RNA polymerase sigma factors 0.0000177 1iw7 F:74-257 Alignments
265 365 Sigma3 and sigma4 domains of RNA polymerase sigma factors 3.55e-28 Sigma4 domain 0.00021 1iw7 F:319-423 Alignments
208 282 Sigma3 and sigma4 domains of RNA polymerase sigma factors 1.2e-21 Sigma3 domain 0.0014 1iw7 F:258-318 Alignments

Protein Sequence Details

Sequence length 369
Comment RNA polymerase sigma factor RpoD [Streptococcus pneumoniae INV104]
Sequence
MATKQKEVTTFDVQVAEFIRNHKQKGTATDDEINASLVIPFTLDADGIEDLLQRIQDAGISITDNEGNPSARVLSNEEEPELSDEDLIGSTSAKVNDPVRMYLKEIGVVPLLTNEEEKELALAVEAGDIEAKQRLAEANLRLVVSIAKRYVGRGMQFLDLIQEGNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMDMTPDKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDEVIENPVDYTTRIVLREQLDEILDTLTDREENVLRLRFGLDDGKMRTLEDVGKVFNVTRERIRQIEAKALRKLRQPSRSKPLRDFIED

Download

Sequence (FASTA)