Domain assignment for gi|387626374|ref|YP_006062549.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 139 Acyl-CoA N-acyltransferases (Nat) 1.17e-25 N-acetyl transferase, NAT 0.016 1y9k A:1-152 Alignments

Protein Sequence Details

Sequence length 143
Comment acetyltransferase (GNAT) family protein [Streptococcus pneumoniae INV104]
Sequence
MLRDLQETDVKAICDINQEALGYTFSPEETASQLARLSQDSHHFLLGYEDAANHVLLGYVHAEVYESLYSKAGFNILALAVSPQAQGQGIGKSLLQGLEQEAKRCGYGFIRLNSANHRLGAHAFYEKVGYTCDKMQKRFIRIF

Download

Sequence (FASTA)