Domain assignment for gi|387626362|ref|YP_006062537.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 291 Chelatase 7.52e-66 Ferrochelatase 0.00000224 1doz A: Alignments

Protein Sequence Details

Sequence length 364
Comment ferrochelatase [Streptococcus pneumoniae INV104]
Sequence
MKKAILMMTFGSPEEISFEGVAEFFTNIRRGVRPQDHEIQTLYDNYIRIGGTPLQRITREEVNLVKERLGEEYGIYFANKFSRPFIPDVIKQMETDGVEECICLILEPHYSFYSVMGYEKFLESKQIQFLVIKDWYQEEVLLNYWADEIAKILKEEVKQDSFKVIFSAHSVPIFALDFGDPYIDQIFENSKLVAEKLGLSSEQYTNTWQSESDIGIPWIKPDVLEYLREQTEHPDHYIFVPISFISEHIEVLFDNDVECYDLCQEFGVNYHRPPMPNTDSRLIDALVNTVRVNENQEFKEFLPEEETFDELVPSDETKNILAESEDLQMPEFVKKLIEKKGRENVKMPYLIKKMLEKAGKLPKE

Download

Sequence (FASTA)