Domain assignment for gi|387626328|ref|YP_006062503.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 132 Small protein B (SmpB) 2.75e-50 Small protein B (SmpB) 0.0000167 1j1h A: Alignments

Protein Sequence Details

Sequence length 155
Comment SsrA-binding protein [Streptococcus pneumoniae INV104]
Sequence
MAKGEGKVVAQNKKARHDYTIVDTLEAGMVLTGTEIKSVRAARINIKDGFAQVKNGEVWLSNVHIAPYEEGNIWNQEPERRRKLLLHKKQIQKLEQETKGTGMTLVPLKVYIKDGYAKLLLGLAKGKHDYDKRESIKRREQNRDIARVMKAVNQR

Download

Sequence (FASTA)