Domain assignment for gi|387626289|ref|YP_006062462.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
67 294 Pseudouridine synthase 1.99e-79 Pseudouridine synthase RsuA/RluD 0.00000428 1prz A: Alignments
10 95 Alpha-L RNA-binding motif 0.0000000000000942 Pseudouridine synthase RsuA N-terminal domain 0.034 1vio A:0-57 Alignments

Protein Sequence Details

Sequence length 295
Comment putative RNA pseudouridylate synthase [Streptococcus pneumoniae INV104]
Sequence
MEIKIETGGLRLDKALSDLSELSRSLANEQIKSGQVLVNGQVKKAKYTVQEGDVVTYHVPEPEVLEYVAEDLPLEIVYQDEDVAVVNKPQGMVVHPSAGHTSGTLVNALMYHIKDLSGINGVLRPGIVHRIDKDTSGLLMIAKNDDAHLVLAQELKDKKSLRKYWAIVHGNLPNDRGVIEAPIGRSEKDRKKQAVTAKGKPAVTRFHVLERFGDYSLVELQLETGRTHQIRVHMAYIGHPVAGDEVYGPRKTLKGHGQFLHAKTLGFTHPRTGKTLEFKADIPEIFKETLERLRK

Download

Sequence (FASTA)