Domain assignment for gi|387626253|ref|YP_006062426.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
15 80 F1F0 ATP synthase subunit C 0.0000000000144 F1F0 ATP synthase subunit C 0.01 1c99 A: Alignments
90 156 F1F0 ATP synthase subunit C 0.00000000667 F1F0 ATP synthase subunit C 0.026 1c99 A: Alignments

Protein Sequence Details

Sequence length 158
Comment V-type sodium ATP synthase subunit K [Streptococcus pneumoniae INV104]
Sequence
MEHLATYFSTYGGAFFAALGIVLAVGLSGMGSAYGVGKAGQSAAALLKEQPEKFASALILQLLPGTQGLYGFVIGILIWLQLTPELPLEKGVAYFFVALPIAIVGYFSAKHQGNVAVAGMQILAKRPKEFMKGAILAAMVETYAILAFVVSFILTLRV

Download

Sequence (FASTA)