Domain assignment for gi|387626192|ref|YP_006062364.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 179 SP0830-like 1.83e-49 SP0830-like 0.0000000101 2hiy A:1-180 Alignments

Protein Sequence Details

Sequence length 180
Comment hypothetical protein INV104_06880 [Streptococcus pneumoniae INV104]
Sequence
MTRYALLVRGINVGGKNKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYHKYLLKVPFYRHITIRNAKTFDKIGQMLKK

Download

Sequence (FASTA)