Domain assignment for gi|387626165|ref|YP_006062337.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 300 NAD(P)-linked oxidoreductase 9.56e-70 Aldo-keto reductases (NADP) 0.00000558 1og6 A: Alignments

Protein Sequence Details

Sequence length 308
Comment putative oxidoreductase [Streptococcus pneumoniae INV104]
Sequence
MRYITLGQDDKELSEIVLGMMRIKDKSVKEVEELVETALSVGINAFDLADIYGRGRCEELLGLVLKNRPDLREKMWIQSKCGIRIEEFTYFDFSKDYIIKSVDGILQRLKIDHLDSLLLHRPDALMESDQVAEAFNLLYKQGKVRDFGVSNQNPMMMELLKKDVKQPLAVNQLQLSAAFTPGFESAFHVNMEDSQAAMRDGSIFEYCQLHDVVIQAWSVLQFGYFKGNFVGNEKFQALNQVLDRLAIKYGVTSSTIAISWILRYPAKMQAVVGTTNPKHLREVSRAANFSLTRKEWYEIYLAAGNNLP

Download

Sequence (FASTA)