Domain assignment for gi|387626149|ref|YP_006062321.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 86 Ribosomal protein S16 4.45e-34 Ribosomal protein S16 0.00026 1fjg P: Alignments

Protein Sequence Details

Sequence length 90
Comment 30S ribosomal protein S16 [Streptococcus pneumoniae INV104]
Sequence
MAVKIRLTRMGSKKKPFYRINVADSRSPRDGRFIETVGTYNPLVAENQVTLKEDRVLAWLANGAQPSDTVRNILSKEGVLKKFHDSKFSK

Download

Sequence (FASTA)