Domain assignment for gi|387626141|ref|YP_006062313.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
216 341 post-AAA+ oligomerization domain-like 3.29e-19 DNA polymerase III clamp loader subunits, C-terminal domain 0.021 1sxj B:231-322 Alignments
13 210 P-loop containing nucleoside triphosphate hydrolases 0.0000303 Extended AAA-ATPase domain 0.034 1iqp A:2-232 Alignments

Protein Sequence Details

Sequence length 345
Comment putative DNA polymerase III delta subunit [Streptococcus pneumoniae INV104]
Sequence
MLAIEESQKLTLSNLPSLSLFTGTDQGQFEVMKSQVLKQIGYDSADLNFAYFDMKEVVYKDVELELVSLPFFADEKIVILDYFMDITTAKKRFLTDDELKSFEEYLDNSSPTTKLIIFAEGKLDSKRRLVKLLKRDAKVFDAVEVKEQELRQYFQKWSQKQGLQFTNHSFENLLIKSGFQFSEIQKNLLFLQSYKANSVIEEEDIVNAIPKTLQDNIFDLTQFILTKKMDQARDLVRDLTLQGEDEIKLIAVMLGQFRTFTQVKILAESGQTESQIASSLGSYLGRNPNPYQIKFALRDSRGLSLSFLKQAISYLIETDYQIKTGLYEKGFLFEKALLQIASQVN

Download

Sequence (FASTA)