Domain assignment for gi|387626117|ref|YP_006062289.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 90 (Trans)glycosidases 3.12e-30 Family 1 of glycosyl hydrolase 0.0013 1od0 A: Alignments

Protein Sequence Details

Sequence length 93
Comment putative glycosyl hydrolase [Streptococcus pneumoniae INV104]
Sequence
MDTPDENGYVADDYRITYLEAHIKAMRDAIYKDGVDLLGYTTWGCIDSVSAGTGEMNKRYGFIYVDRDNVGNGTLKRSKKKSFYWYMSFIAMV

Download

Sequence (FASTA)