Domain assignment for gi|387626113|ref|YP_006062285.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
14 122 Cupredoxins 7.11e-16 Nitrosocyanin 0.029 1iby A: Alignments

Protein Sequence Details

Sequence length 123
Comment hypothetical protein INV104_06070 [Streptococcus pneumoniae INV104]
Sequence
MLNSIVTIICIALIAFILFWFFKKPEKSGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQVGEFGFACGMNMMHGKMIVE

Download

Sequence (FASTA)