Domain assignment for gi|387626087|ref|YP_006062259.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
77 242 Activating enzymes of the ubiquitin-like proteins 6.15e-43 Molybdenum cofactor biosynthesis protein MoeB 0.043 1jw9 B: Alignments

Protein Sequence Details

Sequence length 256
Comment HesA/MoeB/ThiF family protein [Streptococcus pneumoniae INV104]
Sequence
MFYVNSYVFAYKKEGIMYLRGRSMREIAIEPQISQEFINDLFNSCKELLEIEEVLGSKLTFELLNEQILISDEIDIDSRYSRTKGYYSLFYNEEYNKIQNKTVLVLGAGALGCYISLSLSMYGVRKLIVADYDIIEPSNLNRQILYTESDVGKEKINVLSEKIHKYNSDVQVVPISIKVSSVEELEKIVAEYGSIDFIVKAIDTPIDIIKIVNQFAVSHKISYISGGFNGCYLITDNIYPYHRFLLWLSEYKQRYK

Download

Sequence (FASTA)