Domain assignment for gi|387626078|ref|YP_006062250.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
59 231 Pseudouridine synthase 2.56e-39 Pseudouridine synthase RsuA/RluD 0.0000344 1ksk A:60-231 Alignments
1 80 Alpha-L RNA-binding motif 0.000000922 Ribosomal protein S4 0.07 1c06 A: Alignments

Protein Sequence Details

Sequence length 241
Comment putative ribosomal small subunit pseudouridine synthase A [Streptococcus pneumoniae INV104]
Sequence
MRLDNLLAQEKVSRKAMKQALLRGEILVDGCPARSLAQNIDTGLQELLFQDRIIQGYEHTYLMLHKPAGVVTANKDKELPTVMDLLPSDIQSDKLYAVGRLDRDTTGLLLLTDNGPLGFQLLHPQYHVDKTYQVQVNELLTPDHIQAFQKGIVFLDGTVCKPAKLEILSASPSLSQASITISEGKFHQIKKMFLSVGVKVTSLKRIQFGDFTLNPDLAESNYRPLNQKELQIIKNYLEMSR

Download

Sequence (FASTA)