Domain assignment for gi|387626077|ref|YP_006062249.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
9 121 Rhodanese/Cell cycle control phosphatase 1.18e-25 Multidomain sulfurtransferase (rhodanese) 0.024 1yt8 A:6-106 Alignments

Protein Sequence Details

Sequence length 126
Comment hypothetical protein INV104_05690 [Streptococcus pneumoniae INV104]
Sequence
MVTWILWALILAMLAWMGFNYLRIRRAAKIVDNEEFEALIRTGQLIDLRDPAEFHRKHILGARNIPSSQLKTSLAALRKDKPVLLYENQRAQRVTNAALYLKKQGFSEIYILSYGLDSWKGKVKTS

Download

Sequence (FASTA)