Domain assignment for gi|387626068|ref|YP_006062240.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 278 Thymidylate synthase/dCMP hydroxymethylase 3.14e-74 Thymidylate synthase/dCMP hydroxymethylase 0.00000648 1bkp A: Alignments

Protein Sequence Details

Sequence length 279
Comment thymidylate synthase [Streptococcus pneumoniae INV104]
Sequence
MTKADTIFKENIERILKEGVFSEQARPKYKDGTVANSKYVTGAFSEYDLSKGEFPIITLRPIAIKSAIKEVLWIYQDQSNSLEVLNDKYNVHYWNDWEVGDTGTIGERYGAVVKKHDIINKLLKQLETNPWNRRNIISLWDYQAFEETDGLLPCAFQTMFDVRRVDGEIYLDATLTQRSNDMLVAHHINAMQYVALQMMIAKHFGWKVGKFFYFINNLHIYDNQFEQAQELLRREPSNCQPRLVLNVPDGTNFFDIKAEDFELVDYDPVKPQLKFDLAI

Download

Sequence (FASTA)