Domain assignment for gi|387626038|ref|YP_006062210.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 66 SecB-like 0.0000000126 Bacterial protein-export protein SecB 0.016 1ozb A: Alignments

Protein Sequence Details

Sequence length 72
Comment hypothetical protein INV104_05290 [Streptococcus pneumoniae INV104]
Sequence
MKKISVTVIGYFEINIDENITDILYVNGTAILYHYLRSIVSIVSAIDSSEAMLLPTINVLELLDKSQPFEEE

Download

Sequence (FASTA)