Domain assignment for gi|387626032|ref|YP_006062204.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 43 Rhodanese/Cell cycle control phosphatase 0.00000000000144 Single-domain sulfurtransferase 0.02 1gmx A: Alignments

Protein Sequence Details

Sequence length 44
Comment hypothetical protein INV104_05230 [Streptococcus pneumoniae INV104]
Sequence
MDKDRLHYIICKSGMRSARACQFLLEQGYNVINVQGGMLAFEEL

Download

Sequence (FASTA)