Domain assignment for gi|387626022|ref|YP_006062194.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 163 Acyl-CoA N-acyltransferases (Nat) 2.75e-44 FemXAB nonribosomal peptidyltransferases 0.0038 1ne9 A:1-164 Alignments
168 391 Acyl-CoA N-acyltransferases (Nat) 2.91e-29 FemXAB nonribosomal peptidyltransferases 0.005 1lrz A:166-244,A:310-412 Alignments

Protein Sequence Details

Sequence length 406
Comment putative peptidoglycan pentaglycine interpeptide biosynthesis protein [Streptococcus pneumoniae INV104]
Sequence
MYRYQIGIPTLEYDQFVKEHELANVLQSSAWEEVKSNWQHEKFGVYREEKLLATASILIRTLPLGYKMFYIPRGPILDYGDKELLNFAIQSIKSYARSKRAVFVTFDPSICLSQSLINQEKTEFPENLAIIDSLQQMGVRWSGKTEEMGDTIQPRIQAKIYKENFEEDKLSKSTKQAIRTARNKGLEIQYGGLELLDSFSELMKKTEKRKEIHLRNEAYYKKLLDNFKDKAYITLATLDVSKRSQELEEQLAKNRALEETFTESTRTSKVEAQKKEKERLLEELTFLQEYIDVGQARVPLAATLSLEFGTTSVNIYAGMDDDFKRYNAPILTWYETARYAFERGMVWQNLGGVENSLNGGLYHFKEKFNPTIEEYLGEFTMPTHPLYPLLRLALDFRKTLRKKHRK

Download

Sequence (FASTA)