Domain assignment for gi|387626007|ref|YP_006062179.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 126 RNase III domain-like 3.31e-44 RNase III catalytic domain-like 0.00003 1u61 A: Alignments

Protein Sequence Details

Sequence length 128
Comment putative ribomuclease [Streptococcus pneumoniae INV104]
Sequence
MIDVNLINGIALAFEGDAVYSMYIRRHLILKGMTKPNKLHQEATKYVSAKAQARLISLMLEEQILTEKEEEIYKRGRNTNSHTKAKNADVVTYRMSTGFEAVMGYLHMTENLERLESLVSWCIQKVEG

Download

Sequence (FASTA)