Domain assignment for gi|387625997|ref|YP_006062169.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 160 Acyl-CoA N-acyltransferases (Nat) 6.06e-33 N-acetyl transferase, NAT 0.0000684 1tiq A: Alignments

Protein Sequence Details

Sequence length 169
Comment acetyltransferase (GNAT) family protein [Streptococcus pneumoniae INV104]
Sequence
MIRKVEMADVEVLAKIAKQAFRETFAYDNTEEQLQEYFEEAYSLKTLSTELGNPDSETYFIMHEEEIAGFLKVNWGSAQTERELEDAFEIQRLYVLQKFQGFGLGKQLFEFALELATKNSFSWAWLGVWEHNTKAQAFYNRYGFEKFSQHHFMVGQKVDTDWLLRKKLR

Download

Sequence (FASTA)