Domain assignment for gi|387625979|ref|YP_006062151.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 113 Ribosome-binding factor A, RbfA 3.92e-30 Ribosome-binding factor A, RbfA 0.00026 1jos A: Alignments

Protein Sequence Details

Sequence length 116
Comment ribosome-binding factor A [Streptococcus pneumoniae INV104]
Sequence
MANHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDLSVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGNKIDEMLRNLDKN

Download

Sequence (FASTA)