Domain assignment for gi|387625977|ref|YP_006062149.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 98 L30e-like 1.61e-25 L30e/L7ae ribosomal proteins 0.0085 1ffk E: Alignments

Protein Sequence Details

Sequence length 99
Comment ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Streptococcus pneumoniae INV104]
Sequence
MNKQKISNLLGLAQRAGRIISGEELVVKAIQDGKAKLVFLAHDAGPNLTKKIQDKSHYYQVEIVTVFSTLELSIAVGKSRKVLAVTDAGFTKKMRSLME

Download

Sequence (FASTA)