Domain assignment for gi|387625951|ref|YP_006062123.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 104 Chaperone J-domain 6.67e-35 Chaperone J-domain 0.00014 1xbl A: Alignments
264 346 HSP40/DnaJ peptide-binding domain 8.5e-21 HSP40/DnaJ peptide-binding domain 0.0025 1c3g A:260-349 Alignments
115 267 HSP40/DnaJ peptide-binding domain 4.97e-19 HSP40/DnaJ peptide-binding domain 0.0065 1c3g A:260-349 Alignments
135 215 DnaJ/Hsp40 cysteine-rich domain 2.09e-18 DnaJ/Hsp40 cysteine-rich domain 0.00023 1exk A: Alignments

Protein Sequence Details

Sequence length 378
Comment chaperone protein DnaJ [Streptococcus pneumoniae INV104]
Sequence
MNNTEFYDRLGVSKNASADEIKKAYRKLSKKYHPDINKEPGAEDKYKEVQEAYETLSDDQKRAAYDQYGAAGANGGFGGAGGFGGFNGAGGFGGFEDIFSSFFGGGGSSRNPNAPRQGDDLQYRVNLTFEEAIFGTEKEVKYHREAGCRTCNGSGAKPGTSPVTCGRCHGAGVINVDTQTPLGMMRRQVTCDVCHGRGKEIKYPCTTCHGTGHEKQAHSVHVKIPAGVETGQQIRLAGQGEAGFNGGPYGDLYVVVSVEASDKFEREGTTIFYNLNLNFVQAALGDTVDIPTVHGDVELVIPEGTQTGKKFRLRSKGAPSLRGGAVGDQYVTVNVVTPTGLNDRQKVALKEFAAAGDLKVNPKKKGFFDHIKDAFDGE

Download

Sequence (FASTA)