Domain assignment for gi|387625949|ref|YP_006062121.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
28 118 Coiled-coil domain of nucleotide exchange factor GrpE 2.88e-20 Coiled-coil domain of nucleotide exchange factor GrpE 0.0032 1dkg B:38-138 Alignments
126 173 Head domain of nucleotide exchange factor GrpE 0.00000000000017 Head domain of nucleotide exchange factor GrpE 0.0033 1dkg A:139-197 Alignments

Protein Sequence Details

Sequence length 174
Comment GrpE protein (HSP-70 cofactor) [Streptococcus pneumoniae INV104]
Sequence
MAQDIKNEEVEEVQEEEVVETAEETTPEKSELDLANERADEFENKYLRAHAEMQNIQRRANEERQNLQRYRSQDLAKAILPSLDNLERALAVEGLTDDVKKGLGMVQESLIHALKEEGIEEIAADGEFDHNYHMAIQTLPADDEHPVDTIAQVFQKGYKLHDRILRPAMVVVYN

Download

Sequence (FASTA)