Domain assignment for gi|387625942|ref|YP_006062114.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
13 104 Putative DNA-binding domain 8.7e-19 DNA-binding N-terminal domain of transcription activators 0.0074 1q06 A: Alignments

Protein Sequence Details

Sequence length 118
Comment MerR family transcriptional regulator [Streptococcus pneumoniae INV104]
Sequence
MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQELIKPDRNEGNRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRCALHNELLQQGRFASVQSPFGRG

Download

Sequence (FASTA)