Domain assignment for gi|387625901|ref|YP_006062073.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 183 NAD(P)-binding Rossmann-fold domains 3.01e-69 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00000564 1np3 A:1-182 Alignments
184 331 6-phosphogluconate dehydrogenase C-terminal domain-like 1.55e-67 Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) 0.0000074 1np3 A:183-327 Alignments

Protein Sequence Details

Sequence length 340
Comment ketol-acid reductoisomerase [Streptococcus pneumoniae INV104]
Sequence
MTVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDSGRDVIIGVRPGKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAEIAPNLEAGNAVGFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAVYQDATGNAKNIAMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLTALIEAGFEVLTEAGYAPELAYFEVLHEMKLIVDLIYEGGFKKMRQSISNTAEYGDYVSGPRVITEQVKENMKAVLADIQNGKFANDFVNDYKAGRPKLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN

Download

Sequence (FASTA)