Domain assignment for gi|387625895|ref|YP_006062067.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 265 P-loop containing nucleoside triphosphate hydrolases 5.43e-85 G proteins 0.0000452 2bv3 A:7-282 Alignments
249 379 Translation proteins 5.42e-27 Elongation factors 0.0063 2bv3 A:283-403 Alignments
383 454 EF-G C-terminal domain-like 6.47e-16 EF-G/eEF-2 domains III and V 0.0052 1fnm A:404-482 Alignments

Protein Sequence Details

Sequence length 514
Comment peptide chain release factor 3 [Streptococcus pneumoniae INV104]
Sequence
MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKGKKTGTFAKSDWMDIEKQRGISVTSSVMQFDYDGKRVNILDTPGHEDFSEDTYRTLMAVDAAVMVVDSAKGIEAQTKKLFEVVKHRGIPVFTFMNKLDRDGREPLDLLQELEEILGIASYPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNPFYEQVKDDIELLNEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLEIFLKFAPEPHGHKKTDGEIVDPYDKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAESRENVINAVAGDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQKSFHKGIEQLVQEGAVQLYKNYQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMNPMGKKTVRWIKPEDLDERMSSSRNILAKDRFDQPVFLFENDFALRWFADKYPDVELEEKM

Download

Sequence (FASTA)