Domain assignment for gi|387625894|ref|YP_006062066.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 93 Glu-tRNAGln amidotransferase C subunit 5.1e-27 Glu-tRNAGln amidotransferase C subunit 0.0003 2f2a C:3-94 Alignments

Protein Sequence Details

Sequence length 100
Comment glutamyl-tRNA amidotransferase subunit C [Streptococcus pneumoniae INV104]
Sequence
MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPEQDNYYIKVPAILDDGGDA

Download

Sequence (FASTA)