Domain assignment for gi|387625883|ref|YP_006062055.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 138 Thioesterase/thiol ester dehydrase-isomerase 2.07e-47 FabZ-like 0.0000876 1u1z A: Alignments

Protein Sequence Details

Sequence length 140
Comment (3R)-hydroxymyristoyl-ACP dehydratase [Streptococcus pneumoniae INV104]
Sequence
MIDIQGIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFFNGHFPQYPVMPGVLIMEALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQLVMTATFVKRRGTIAVVEAKAEVDGKLAASGTLTFAIGN

Download

Sequence (FASTA)