Domain assignment for gi|387625879|ref|YP_006062051.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 303 FabD/lysophospholipase-like 1.75e-74 FabD-like 0.0000055 1mla A:3-127,A:198-307 Alignments
127 195 Probable ACP-binding domain of malonyl-CoA ACP transacylase 3.92e-17 Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00054 1mla A:128-197 Alignments

Protein Sequence Details

Sequence length 306
Comment putative malonyl CoA-acyl carrier protein transacylase [Streptococcus pneumoniae INV104]
Sequence
MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLRYLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPAQIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTALLEPASQKLAETLAQVSFSDFTCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGFVKKIDQTAHLAHVEDQASLVALLEK

Download

Sequence (FASTA)