Domain assignment for gi|387625853|ref|YP_006062025.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 128 CheY-like 1.1e-32 CheY-related 0.00027 1a04 A:5-142 Alignments
131 205 C-terminal effector domain of the bipartite response regulators 6.46e-24 GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0021 1a04 A:150-216 Alignments

Protein Sequence Details

Sequence length 210
Comment response regulator protein [Streptococcus pneumoniae INV104]
Sequence
MKILLVDDHEMVRLGLKSYFDLQDDVEVVGEASNGSQGIDLALELRPDVIVMDIVMPEMNGIDATLAILKEWPEAKILIVTSYLDNEKIMPVLDAGAKGYMLKTSSADELLHAVSKVAAGELAIEQEVSKKVEYHRNHMELHEELTARERDVLQLIAKGYENQRIADDLFISLKTVKTHVSNILAKLEVSDRTQAAVYAFQHHLVGQEEF

Download

Sequence (FASTA)