Domain assignment for gi|387625849|ref|YP_006062021.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 192 Ribosomal protein S5 domain 2-like 4.71e-47 GHMP Kinase, N-terminal domain 0.00000000946 1k47 A:1-194 Alignments
196 327 GHMP Kinase, C-terminal domain 5.28e-32 Phosphomevalonate kinase (PMK) 0.000000663 1k47 A:195-329 Alignments

Protein Sequence Details

Sequence length 335
Comment phosphomevalonate kinase [Streptococcus pneumoniae INV104]
Sequence
MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYRIYSDMFDFAVDLTPNPDYSLIQETIALMGDFLAVRGQNLRSFSLEICGKMEREGKKFGLGSSGSVVVLVVKALLALYDVSVDQELLFKLTSAVLLKRGDNGSMGDLACIVAEDLVLYQSFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQNINQNFLSSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEASQDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERIGHDDKS

Download

Sequence (FASTA)