Domain assignment for gi|387625825|ref|YP_006061997.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
51 171 Trimeric LpxA-like enzymes 5.11e-29 Galactoside acetyltransferase-like 0.022 1ocx A: Alignments

Protein Sequence Details

Sequence length 183
Comment galacturonic acid acetyl transferase [Streptococcus pneumoniae INV104]
Sequence
MNRIIKNIVGLLRANICLILLKVCRNKDLTFHYFLKFGKNVTVEQESNAKLILGKKIRVNAGGVLKVRKGAKLKISDDVFLSNNCMIACRKYIDIKSGVKCGPGVLIYDHDYDVSVPGGLKAKKFKTAPVMIGENVWIGANSIVLKGVSIGENSVVAAGSVVTKDIPADTIFIQKRLSREMKL

Download

Sequence (FASTA)