Domain assignment for gi|387625804|ref|YP_006061976.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 314 S-adenosyl-L-methionine-dependent methyltransferases 6.22e-44 MraW-like putative methyltransferases 0.00012 1wg8 A:5-108,A:207-284 Alignments
118 219 Putative methyltransferase TM0872, insert domain 1.57e-35 Putative methyltransferase TM0872, insert domain 0.00011 1wg8 A:109-206 Alignments

Protein Sequence Details

Sequence length 316
Comment S-adenosyl-methyltransferase MraW [Streptococcus pneumoniae INV104]
Sequence
MTKEFHHVTVLLHETIDMLDVKPDGIYVDATLGGAGHSEYLLSKLSEKGHLYAFDQDQNAIDNAQKRLAPYIEKGMVTFIKDNFRHLQARLREAGVQEIDGICYDLGVSSPQLDQRERGFSYKKDAPLDMRMNQDASLTAYEVVNNYDYHDLVRIFFKYGEDKFSKQIARKIEQAREVKPIETTTELAEIIKLVKPAKELKKKGHPAKQIFQAIRIEVNDELGAADESIHQAMDMLALDGRISVITFHSLEDRLTKQLFKEASTVEVPKGLPFIPDDLKPKMELVSRKPILPSAEELEANNRSHSAKLRVARKIHK

Download

Sequence (FASTA)